PDB entry 3vzm

View 3vzm on RCSB PDB site
Description: Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) E172H mutant with Glu78 covalently bonded to 2-deoxy-2-fluoro-xylobiose
Class: hydrolase/hydrolase inhibitor
Keywords: xylanase, GH-11 glycoside hydrolase, glycosyl-enzyme intermediate, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-10-15, released 2013-05-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.175
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Bacillus circulans [TaxId:1397]
    Gene: xlnA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09850 (0-184)
      • engineered mutation (171)
    Domains in SCOPe 2.04: d3vzma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vzmA (A:)
    astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
    ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmathgyqssgss
    nvtvw