PDB entry 3vzm

View 3vzm on RCSB PDB site
Description: Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) E172H mutant with Glu78 covalently bonded to 2-deoxy-2-fluoro-xylobiose
Class: hydrolase/hydrolase inhibitor
Keywords: xylanase, GH-11 glycoside hydrolase, glycosyl-enzyme intermediate, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-10-15, released 2013-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endo-1,4-beta-xylanase
  Species: Bacillus circulans [TaxId:1397]
  Gene: xlnA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09850 (0-184)
    • engineered mutation (171)
  Domains in SCOPe 2.08: d3vzma_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3vzmA (A:)
  astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
  ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
  drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmathgyqssgss
  nvtvw