PDB entry 3vyv

View 3vyv on RCSB PDB site
Description: Crystal structure of subtilisin NAT at 1.36
Class: hydrolase
Keywords: Bacillus subtilis subsp. natto, serine protease, O-Benzylsulfonyl-serine, HYDROLASE
Deposited on 2012-10-03, released 2013-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: 0.148
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Subtilisin NAT
    Species: Bacillus subtilis subsp. natto [TaxId:86029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vyva_
  • Chain 'B':
    Compound: Subtilisin NAT
    Species: Bacillus subtilis subsp. natto [TaxId:86029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vyvb_
  • Heterogens: GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vyvA (A:)
    aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
    gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
    vinmslggptgstalktvvdkavssgivvaaaagnegssgststvgypakypstiavgav
    nssnqrasfssvgseldvmapgvsiqstlpggtygayngtsmatphvagaaalilskhpt
    wtnaqvrdrlestatylgnsfyygkglinvqaaaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vyvB (B:)
    aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
    gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
    vinmslggptgstalktvvdkavssgivvaaaagnegssgststvgypakypstiavgav
    nssnqrasfssvgseldvmapgvsiqstlpggtygayngtsmatphvagaaalilskhpt
    wtnaqvrdrlestatylgnsfyygkglinvqaaaq