PDB entry 3vyr

View 3vyr on RCSB PDB site
Description: Crystal structure of the HypC-HypD complex
Class: metal binding protein
Keywords: [NiFe] hydrogenase maturation, METAL BINDING PROTEIN
Deposited on 2012-10-02, released 2012-11-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.17
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrogenase expression/formation protein HypC
    Species: Thermococcus kodakarensis [TaxId:69014]
    Gene: Tk-hypC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vyra_
  • Chain 'B':
    Compound: Hydrogenase expression/formation protein hypD
    Species: Thermococcus kodakarensis [TaxId:69014]
    Gene: Tk-hypD
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CIT, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3vyrA (A:)
clavpgkvievngpvavvdfggvkrevrldlmpdtkpgdwvivhtgfaiekldekkamei
leawaevekamegf

    Sequence, based on observed residues (ATOM records): (download) 
    >3vyrA (A:)
avpgkvievngpvavvdfggvkrevrldlmpdtkpgdwvivhtgfaiekldekkameile
awaevekamegf

  • Chain 'B':
    No sequence available.