PDB entry 3vym

View 3vym on RCSB PDB site
Description: Dimeric Hydrogenobacter thermophilus cytochrome c552
Class: Electron Transport
Keywords: Electron Transport
Deposited on 2012-09-28, released 2012-11-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c-552
    Species: Hydrogenobacter thermophilus [TaxId:608538]
    Gene: HTH_0988, Hydth_0984
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3vyma_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3vymA (A:)
neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
pqnvtdaeakqlaqwilsik