PDB entry 3vyj

View 3vyj on RCSB PDB site
Description: Crystal structure of C-type lectin domain of murine dendritic cell inhibitory receptor 2 (apo form)
Class: carbohydrate binding protein
Keywords: C-type lectin fold, cell surface, CARBOHYDRATE BINDING PROTEIN
Deposited on 2012-09-26, released 2013-10-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.237
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4, member a4
    Species: Mus musculus [TaxId:10090]
    Gene: Dcir2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5YIR8 (2-128)
      • expression tag (1)
    Domains in SCOPe 2.04: d3vyja_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vyjA (A:)
    gscpkdwkpfvshcyfilndskaswneseekcshmgahlvvihsqaeqdfitsnlntsag
    yfiglldagqrqwrwidqtpynksatfwhkgepnqdwercviinhkttgwgwndipckde
    hnsvcqvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vyjA (A:)
    scpkdwkpfvshcyfilndskaswneseekcshmgahlvvihsqaeqdfitsnlntsagy
    figlldagqrqwrwidqtpynksatfwhkgepnqdwercviinhkttgwgwndipckdeh
    nsvcqvkk