PDB entry 3vxv

View 3vxv on RCSB PDB site
Description: Crystal structure of methyl CpG Binding Domain of MBD4 in complex with the 5mCG/TG sequence
Class: hydrolase/DNA
Keywords: methyl CpG binding domain, protein-DNA complex, versatile base recognition, HYDROLASE-DNA complex
Deposited on 2012-09-21, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyl-CpG-binding domain protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: Mbd4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vxva_
  • Chain 'B':
    Compound: DNA (5'-d(*gp*tp*cp*ap*cp*tp*ap*cp*(5cm)p*gp*gp*ap*cp*a)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*gp*tp*cp*tp*gp*gp*tp*ap*gp*tp*gp*ap*cp*t)-3')
  • Heterogens: ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vxvA (A:)
    sghkpvpcgwervvkqrlsgktagkfdvyfispqglkfrskrslanyllkngetflkped
    fnftvlpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxvA (A:)
    kpvpcgwervvkqrlsgktagkfdvyfispqglkfrskrslanyllkngetflkpedfnf
    tvlpk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.