PDB entry 3vxt

View 3vxt on RCSB PDB site
Description: T36-5 TCR specific for HLA-A24-Nef134-10
Class: immune system
Keywords: hiv-1, nef, immune system, t cell receptor, immunogloburin domain, tcr, immune response
Deposited on 2012-09-20, released 2013-10-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T36-5 TCR alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VXT
    Domains in SCOPe 2.03: d3vxta1, d3vxta2
  • Chain 'B':
    Compound: T36-5 TCR beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VXT (Start-241)
    Domains in SCOPe 2.03: d3vxtb1, d3vxtb2
  • Chain 'C':
    Compound: T36-5 TCR alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VXT
    Domains in SCOPe 2.03: d3vxtc1, d3vxtc2
  • Chain 'D':
    Compound: T36-5 TCR beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3VXT (Start-241)
    Domains in SCOPe 2.03: d3vxtd1, d3vxtd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vxtA (A:)
    mqkeveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedg
    rftaqlnkasqyvsllirdsqpsdsatylwgtynqggklifgqgtelsvkpniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxtA (A:)
    keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
    taqlnkasqyvsllirdsqpsdsatylwgtynqggklifgqgtelsvkpniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vxtB (B:)
    meaqvtqnprylitvtgkkltvtcsqnmnheymswyrqdpglglrqiyysmnvevtdkgd
    vpegykvsrkekrnfplilespspnqtslyfcassgasheqyfgpgtrltvtedlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxtB (B:)
    eaqvtqnprylitvtgkkltvtcsqnmnheymswyrqdpglglrqiyysmnvevtdkgdv
    pegykvsrkekrnfplilespspnqtslyfcassgasheqyfgpgtrltvtedlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vxtC (C:)
    mqkeveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedg
    rftaqlnkasqyvsllirdsqpsdsatylwgtynqggklifgqgtelsvkpniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxtC (C:)
    keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
    taqlnkasqyvsllirdsqpsdsatylwgtynqggklifgqgtelsvkpniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vxtD (D:)
    meaqvtqnprylitvtgkkltvtcsqnmnheymswyrqdpglglrqiyysmnvevtdkgd
    vpegykvsrkekrnfplilespspnqtslyfcassgasheqyfgpgtrltvtedlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxtD (D:)
    eaqvtqnprylitvtgkkltvtcsqnmnheymswyrqdpglglrqiyysmnvevtdkgdv
    pegykvsrkekrnfplilespspnqtslyfcassgasheqyfgpgtrltvtedlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d