PDB entry 3vxi

View 3vxi on RCSB PDB site
Description: Dye-decolorizing peroxidase (DyP) complex with ascorbic acid
Class: oxidoreductase
Keywords: DyP, Dye-decolorizing peroxidase, ascorbic acid, OXIDOREDUCTASE
Deposited on 2012-09-14, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DyP
    Species: Bjerkandera adusta [TaxId:5331]
    Gene: dyp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vxia_
  • Heterogens: HEM, ASC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vxiA (A:)
    andtilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdps
    qqplafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgv
    fligsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtg
    wettvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaip
    ansagnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltde
    trcpfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyq
    siigngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfv
    ipkggeyfflpsisaltatiaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxiA (A:)
    ilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdpsqqpl
    afvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgvflig
    sdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtgwett
    vfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaipansa
    gnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltdetrcp
    fgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyqsiig
    ngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfvipkg
    geyfflpsisaltatiaa