PDB entry 3vxd

View 3vxd on RCSB PDB site
Description: Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae
Class: hydrolase
Keywords: alpha6/alpha6-barrel, Hydrolase
Deposited on 2012-09-11, released 2012-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein gbs1889
    Species: Streptococcus agalactiae [TaxId:211110]
    Gene: gbs1889
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8E372 (Start-397)
      • engineered mutation (114)
    Domains in SCOPe 2.08: d3vxda_
  • Chain 'B':
    Compound: Putative uncharacterized protein gbs1889
    Species: Streptococcus agalactiae [TaxId:211110]
    Gene: gbs1889
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8E372 (0-397)
      • engineered mutation (114)
    Domains in SCOPe 2.08: d3vxdb_
  • Chain 'C':
    Compound: Putative uncharacterized protein gbs1889
    Species: Streptococcus agalactiae [TaxId:211110]
    Gene: gbs1889
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8E372 (0-397)
      • engineered mutation (114)
    Domains in SCOPe 2.08: d3vxdc_
  • Chain 'D':
    Compound: Putative uncharacterized protein gbs1889
    Species: Streptococcus agalactiae [TaxId:211110]
    Gene: gbs1889
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8E372 (0-397)
      • engineered mutation (114)
    Domains in SCOPe 2.08: d3vxdd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vxdA (A:)
    mmkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnni
    ykvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhnlgfly
    tpsctaeyringdvkaleatikaadklmeryqekggfiqawgelgykehyrliidcllni
    qllffayeqtgdekyrqvavnhfyasannvvrddssafhtfyfdpetgeplkgvtrqgys
    desswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsg
    qprdtsatatavcgihemlkylpevdpdketykyamhtmlrslieqysnneliagrplll
    hgvyswhsgkgvdegniwgdyyylealirfykdwelyw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxdA (A:)
    mkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnniy
    kvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhnlgflyt
    psctaeyringdvkaleatikaadklmeryqeliidcllniqllffayeqtgdekyrqva
    vnhfyasannvvrddssafhtfsswargqawgiygiplsyrkmkdyqqiilfkgmtnyfl
    nrlpedkvsywdliftdgsgqprdtsatatavcgihemlkylpevdpdketykyamhtml
    rslieqysnneliagrplllhgvyswhsgkgvdegniwgdyyylealirfykdwelyw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vxdB (B:)
    mmkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnni
    ykvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhnlgfly
    tpsctaeyringdvkaleatikaadklmeryqekggfiqawgelgykehyrliidcllni
    qllffayeqtgdekyrqvavnhfyasannvvrddssafhtfyfdpetgeplkgvtrqgys
    desswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsg
    qprdtsatatavcgihemlkylpevdpdketykyamhtmlrslieqysnneliagrplll
    hgvyswhsgkgvdegniwgdyyylealirfykdwelyw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxdB (B:)
    mmkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnni
    ykvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhnlgfly
    tpsctaeyringdvkaleatikaadklmeryliidcllniqllffayeqtgdekyrqvav
    nhfyasannvvrddssafsswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlp
    edkvsywdliftdgsgqprdtsatatavcgihemlkylpevdpdketykyamhtmlrsli
    eqysnneliagrplllhgvyswhsgkgvdegniwgdyyylealirfykdwelyw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vxdC (C:)
    mmkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnni
    ykvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhnlgfly
    tpsctaeyringdvkaleatikaadklmeryqekggfiqawgelgykehyrliidcllni
    qllffayeqtgdekyrqvavnhfyasannvvrddssafhtfyfdpetgeplkgvtrqgys
    desswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsg
    qprdtsatatavcgihemlkylpevdpdketykyamhtmlrslieqysnneliagrplll
    hgvyswhsgkgvdegniwgdyyylealirfykdwelyw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxdC (C:)
    mmkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnni
    ykvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhnlgfly
    tpsctaeyringdvkaleatikaadklmeryqliidcllniqllffayeqtgdekyrqva
    vnhfyasannvvrddssafhtfysswargqawgiygiplsyrkmkdyqqiilfkgmtnyf
    lnrlpedkvsywdliftdgsgqprdtsatatavcgihemlkylpevdpdketykyamhtm
    lrslieqysnneliagrplllhgvyswhsgkgvdegniwgdyyylealirfykdwelyw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vxdD (D:)
    mmkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnni
    ykvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhnlgfly
    tpsctaeyringdvkaleatikaadklmeryqekggfiqawgelgykehyrliidcllni
    qllffayeqtgdekyrqvavnhfyasannvvrddssafhtfyfdpetgeplkgvtrqgys
    desswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsg
    qprdtsatatavcgihemlkylpevdpdketykyamhtmlrslieqysnneliagrplll
    hgvyswhsgkgvdegniwgdyyylealirfykdwelyw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vxdD (D:)
    mmkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnni
    ykvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhnlgfly
    tpsctaeyringdvkaleatikaadklmeryliidcllniqllffayeqtgdekyrqvav
    nhfyasannvvrddssafswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlpe
    dkvsywdliftdgsgqprdtsatatavcgihemlkylpevdpdketykyamhtmlrslie
    qysnneliagrplllhgvyswhsgkgvdegniwgdyyylealirfykdwelyw