PDB entry 3vw9

View 3vw9 on RCSB PDB site
Description: Human Glyoxalase I with an N-hydroxypyridone inhibitor
Class: lyase/lyase inhibitor
Keywords: Glyoxalase, LYASE-LYASE INHIBITOR complex
Deposited on 2012-08-10, released 2012-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.166
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactoylglutathione lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: Glo1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3vw9a_
  • Chain 'B':
    Compound: lactoylglutathione lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: Glo1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3vw9b_
  • Heterogens: ZN, EPE, HPJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vw9A (A:)
    gshmaepqppsggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtl
    iqkcdfpimkfslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhn
    gnsdprgfghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnp
    nkmatlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vw9A (A:)
    ggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkcdfpimkf
    slyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfghi
    giavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkmatlm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vw9B (B:)
    gshmaepqppsggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtl
    iqkcdfpimkfslyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhn
    gnsdprgfghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnp
    nkmatlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vw9B (B:)
    ggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkcdfpimkf
    slyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfghi
    giavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkmatlm