PDB entry 3vvw

View 3vvw on RCSB PDB site
Description: NDP52 in complex with LC3C
Class: protein transport
Keywords: autophagy adaptor protein, PROTEIN TRANSPORT
Deposited on 2012-07-28, released 2013-02-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-binding and coiled-coil domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CALCOCO2, NDP52
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Microtubule-associated proteins 1A/1B light chain 3C
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP1LC3C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3vvwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vvwB (B:)
    gpmpppqkipsvrpfkqrkslairqeevagirakfpnkipvvverypretflppldktkf
    lvpqeltmtqflsiirsrmvlrateafyllvnnkslvsmsatmaeiyrdykdedgfvymt
    yasqetfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vvwB (B:)
    fkqrkslairqeevagirakfpnkipvvverypretflppldktkflvpqeltmtqflsi
    irsrmvlrateafyllvnnkslvsmsatmaeiyrdykdedgfvymtyasqetfg