PDB entry 3vuz

View 3vuz on RCSB PDB site
Description: Crystal structure of histone methyltransferase SET7/9 in complex with AAM-1
Class: transferase/transferase inhibitor
Keywords: SET domain, transferase, adenosylmethionine binding, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-07-10, released 2013-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase SETD7
    Species: Homo sapiens [TaxId:9606]
    Gene: SETD7, KIAA1717, KMT7, SET7, SET9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTS6
      • expression tag (0-6)
    Domains in SCOPe 2.07: d3vuza1, d3vuza2, d3vuza3
  • Heterogens: K15, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vuzA (A:)
    gssgssgkdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidge
    miegklatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaesli
    ssageglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynh
    vskycaslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppg
    ksgpeapewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vuzA (A:)
    gssgssghgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegk
    latlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissage
    glfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskyc
    aslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydheapewyqve
    lkafqa