PDB entry 3vup

View 3vup on RCSB PDB site
Description: Beta-1,4-mannanase from the common sea hare Aplysia kurodai
Class: hydrolase
Keywords: Tim Barrel, Beta-1,4-mannanase, mannan, digestive fluid, HYDROLASE
Deposited on 2012-07-04, released 2012-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.138
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-1,4-mannanase
    Species: Aplysia kurodai [TaxId:6501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vupa_
  • Chain 'B':
    Compound: beta-1,4-mannanase
    Species: Aplysia kurodai [TaxId:6501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vupb_
  • Heterogens: TRS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vupA (A:)
    rlhiqnghfvlngqrvflsggnlpwmsyaydfgdgqwqrnknriepefkklhdaggnsmr
    lwihiqgettpafndqgfvtgpdkqgtmlddmkdlldtakkynilvfpclwnaavnqdsh
    nrldglikdqhklqsyidkalkpivnhvkghvalggwdlmnepegmmipdkhnaekcydt
    talknsgagwagnkylyqdilrflnwqadaikttdpgalvtmgvwnpksntdhfnmnnhy
    sdhclrlaggkqkgvfdfyqfhsyswqgkwdevapfthqasdyglhkpivvgefweqdgg
    gmtitqmfnyvynhgyagawswhlvqrgdnqrkgitnikdktsngkipisl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vupB (B:)
    rlhiqnghfvlngqrvflsggnlpwmsyaydfgdgqwqrnknriepefkklhdaggnsmr
    lwihiqgettpafndqgfvtgpdkqgtmlddmkdlldtakkynilvfpclwnaavnqdsh
    nrldglikdqhklqsyidkalkpivnhvkghvalggwdlmnepegmmipdkhnaekcydt
    talknsgagwagnkylyqdilrflnwqadaikttdpgalvtmgvwnpksntdhfnmnnhy
    sdhclrlaggkqkgvfdfyqfhsyswqgkwdevapfthqasdyglhkpivvgefweqdgg
    gmtitqmfnyvynhgyagawswhlvqrgdnqrkgitnikdktsngkipisl