PDB entry 3vun

View 3vun on RCSB PDB site
Description: Crystal structure of a influenza A virus (A/Aichi/2/1968 H3N2) hemagglutinin in C2 space group.
Class: viral protein
Keywords: VIRAL ENVELOPE PROTEIN, MEMBRANE FUSION, Glycosilation, VIRAL PROTEIN
Deposited on 2012-07-02, released 2012-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:387139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437
      • see remark 999 (143)
      • see remark 999 (181)
    Domains in SCOPe 2.07: d3vuna_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:387139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437 (0-End)
      • see remark 999 (131)
    Domains in SCOPe 2.07: d3vunb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:387139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437
      • see remark 999 (143)
      • see remark 999 (181)
    Domains in SCOPe 2.07: d3vunc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:387139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437 (0-End)
      • see remark 999 (131)
    Domains in SCOPe 2.07: d3vund_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:387139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437
      • see remark 999 (143)
      • see remark 999 (181)
    Domains in SCOPe 2.07: d3vune_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:387139]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437 (0-End)
      • see remark 999 (131)
    Domains in SCOPe 2.07: d3vunf_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vunA (A:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpssgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vunA (A:)
    dnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpssgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vunB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vunB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vunC (C:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpssgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vunC (C:)
    dnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpssgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vunD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vunD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3vunE (E:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpssgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vunE (E:)
    dnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpssgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3vunF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vunF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi