PDB entry 3vu8

View 3vu8 on RCSB PDB site
Description: Metionyl-tRNA synthetase from Thermus thermophilus complexed with methionyl-adenylate analogue
Class: ligase
Keywords: protein Met-AMP complex, LIGASE
Deposited on 2012-06-22, released 2013-06-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine--tRNA ligase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: metS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vu8a1, d3vu8a2
  • Heterogens: ZN, MDS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vu8A (A:)
    mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
    qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
    eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
    irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtyvwfdallnyvsaldy
    pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
    tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryeadladdlgnlvqrt
    ramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeamayvkalnryine
    kkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralglkeevrleeaer
    wglaeprpipeeapvlfpkkea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vu8A (A:)
    mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
    qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
    eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
    irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtyvwfdallnyvsaldy
    pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
    tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryeadladdlgnlvqrt
    ramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeamayvkalnryine
    kkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralglkeevrleeaer
    wglaeprpipeeapvlfpkk