PDB entry 3vtj

View 3vtj on RCSB PDB site
Description: Cytochrome P450SP alpha (CYP152B1) mutant A245H
Class: oxidoreductase
Keywords: Cytochrome P450, Peroxygenase, Oxidoreductase
Deposited on 2012-05-30, released 2013-06-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.19
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid alpha-hydroxylase
    Species: SPHINGOMONAS PAUCIMOBILIS [TaxId:13689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24782 (Start-414)
      • engineered mutation (244)
    Domains in SCOPe 2.03: d3vtja_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vtjA (A:)
    mpktphtkgpdetlslladpyrfisrqcqrlganafesrfllkktnclkgakaaeifydt
    trferegampvaiqktllgqggvqgldgethrhrkqmfmglmtpervralaqlfeaewrr
    avpgwtrkgeivfydelhepltravcawagvplpddeagnragelralfdaagsasprhl
    wsrlarrrvdawakriiegiragsigsgsgtaayaiawhrdrhddllsphvaavelvnvl
    rptvhiavyitfvahalqtcsgiraalvqqpdyaelfvqevrrfypffpavvarasqdfe
    wegmafpegrqvvldlygsnhdaatwadpqefrperfrawdedsfnfipqgggdhylghr
    cpgewivlaimkvaahllvnamrydvpdqdlsidfarlpalpksgfvmrnvhigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vtjA (A:)
    gpdetlslladpyrfisrqcqrlganafesrfllkktnclkgakaaeifydttrferega
    mpvaiqktllgqggvqgldgethrhrkqmfmglmtpervralaqlfeaewrravpgwtrk
    geivfydelhepltravcawagvplpddeagnragelralfdaagsasprhlwsrlarrr
    vdawakriiegiragsigsgsgtaayaiawhrdrhddllsphvaavelvnvlrptvhiav
    yitfvahalqtcsgiraalvqqpdyaelfvqevrrfypffpavvarasqdfewegmafpe
    grqvvldlygsnhdaatwadpqefrperfrawdedsfnfipqgggdhylghrcpgewivl
    aimkvaahllvnamrydvpdqdlsidfarlpalpksgfvmrnvhigg