PDB entry 3vsq

View 3vsq on RCSB PDB site
Description: Crystal Structure of the Cytoplasmic Domain of G-Protein-Gated Inward Rectifier Potassium Channel Kir3.2 E236R Mutant in the presence of ethanol
Class: transport protein
Keywords: immunoglobulin-like fold, TRANSPORT PROTEIN
Deposited on 2012-05-02, released 2013-05-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G protein-activated inward rectifier potassium channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnj6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C4T8
    • Uniprot Q8C4T8 (26-End)
      • engineered mutation (62)
    Domains in SCOPe 2.06: d3vsqa_
  • Heterogens: BME, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vsqA (A:)
    gshmrkiqryvrkdgkcnvhhgnvrekraetlvfsthavismrdgklclmfrvgdlrnsh
    ivrasiraklikskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfwe
    iskaqlpkeeleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdy
    nsfhetyetstpslsakelaelanrael
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vsqA (A:)
    qryvrkdgkcnvhhgnvkraetlvfsthavismrdgklclmfrvgdlrnshivrasirak
    likskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlpke
    eleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhetyet
    stpslsakelaelanra