PDB entry 3vsp

View 3vsp on RCSB PDB site
Description: Human PPAR gamma ligand binding domain in complex with a gamma selective agonist mekt28
Class: transcription
Keywords: Mainly alpha, Nuclear receptor, Transcription
Deposited on 2012-04-30, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vspa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vspb_
  • Heterogens: EK8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vspA (A:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vspA (A:)
    qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
    kfskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmla
    slmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiavi
    ilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvq
    llqvikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vspB (B:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vspB (B:)
    esadlralakhlydsyiksfpltkakarailtgktspfviydmnslmmgedkikfkhitp
    kevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslm
    nkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviils
    gdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllq
    vikktetdmslhpllqeiy