PDB entry 3vrm

View 3vrm on RCSB PDB site
Description: Structure of cytochrome P450 Vdh mutant T107A with bound vitamin D3
Class: oxidoreductase
Keywords: CYTOCHROME P450, VITAMIN D3, MONOOXYGENASE, OXIDOREDUCTASE, P450 fold, Hemoprotein
Deposited on 2012-04-12, released 2013-04-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.189
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D(3) 25-hydroxylase
    Species: Pseudonocardia autotrophica [TaxId:2074]
    Gene: vdh
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4B644 (Start-402)
      • engineered mutation (106)
    Domains in SCOPe 2.03: d3vrma_
  • Heterogens: HEM, VD3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vrmA (A:)
    maltttgteqhdlfsgtfwqnphpayaalraedpvrklalpdgpvwlltryadvreafvd
    prlskdwrhtlpedqradmpatptpmmilmdppdhtrlrklvgrsfavrrmneleprite
    iadgllaglptdgpvdlmreyafqipvqvicellgvpaedrddfsawssvlvddspaddk
    naamgklhgylsdllerkrtepddallssllavsdedgdrlsqeelvamamllliaghet
    tvnligngvlallthpdqrkllaedpslissaveeflrfdspvsqapirftaedvtysgv
    tipagemvmlglaaanrdadwmpepdrlditrdasggvffghgihfclgaqlarlegrva
    igrlfadrpelalavgldelvyrestlvrglsrmpvtmgprsalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vrmA (A:)
    altttgteqhdlfsgtfwqnphpayaalraedpvrklalpdgpvwlltryadvreafvdp
    rlskdwrhtlpedqradmpatptpmmilmdppdhtrlrklvgrsfavrrmnelepritei
    adgllaglptdgpvdlmreyafqipvqvicellgvpaedrddfsawssvlvddspaddkn
    aamgklhgylsdllerkrtepddallssllavsdedgdrlsqeelvamamllliaghett
    vnligngvlallthpdqrkllaedpslissaveeflrfdspvsqapirftaedvtysgvt
    ipagemvmlglaaanrdadwmpepdrlditrdasggvffghgihfclgaqlarlegrvai
    grlfadrpelalavgldelvyrestlvrglsrmpvtmgprsa