PDB entry 3vrg

View 3vrg on RCSB PDB site
Description: The crystal structure of hemoglobin from woolly mammoth in the met form
Class: oxygen transport
Keywords: woolly mammoth hemoglobin, oxygen transport, OXYGEN STORAGE/TRANSPORT
Deposited on 2012-04-09, released 2012-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Mammuthus primigenius [TaxId:37349]
    Gene: HBA-T2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3vrga_
  • Chain 'B':
    Compound: Hemoglobin subunit beta/delta hybrid
    Species: Mammuthus primigenius [TaxId:37349]
    Gene: HBB/D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3vrgb_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vrgA (A:)
    vlsdndktnvkatwskvgdhasdyvaealermffsfpttktyfphfdlshgsgqvkghgk
    kvgealtqavghlddlpsalsalsdlhahklrvdpvnfkllshcllvtlsshqpteftpe
    vhasldkflsnvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vrgB (B:)
    vnltaaektqvanlwgkvnvkelggealsrllvvypwtrrffehfgdlstadavlhnakv
    lahgekvltsfgeglkhldnlkgtfsdlselhcdklhvdpqnfrllgnvlvivlarhfgk
    eftpdvqaayekvvagvanalahkyh