PDB entry 3vrf

View 3vrf on RCSB PDB site
Description: The crystal structure of hemoglobin from woolly mammoth in the carbonmonoxy forms
Class: oxygen transport
Keywords: woolly mammoth hemoglobin, oxygen transport, OXYGEN STORAGE/TRANSPORT
Deposited on 2012-04-09, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.172
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Mammuthus primigenius [TaxId:37349]
    Gene: HBA-T2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vrfa_
  • Chain 'B':
    Compound: Hemoglobin subunit beta/delta hybrid
    Species: Mammuthus primigenius [TaxId:37349]
    Gene: HBB/D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vrfb_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3vrfA (A:)
vlsdndktnvkatwskvgdhasdyvaealermffsfpttktyfphfdlshgsgqvkghgk
kvgealtqavghlddlpsalsalsdlhahklrvdpvnfkllshcllvtlsshqpteftpe
vhasldkflsnvstvltskyr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3vrfB (B:)
vnltaaektqvanlwgkvnvkelggealsrllvvypwtrrffehfgdlstadavlhnakv
lahgekvltsfgeglkhldnlkgtfsdlselhcdklhvdpqnfrllgnvlvivlarhfgk
eftpdvqaayekvvagvanalahkyh