PDB entry 3vrd

View 3vrd on RCSB PDB site
Description: Crystal structure of flavocytochrome c from Thermochromatium tepidum
Class: electron transport/oxidoreductase
Keywords: sulfide oxidation, Heme c binding, FAD binding, ELECTRON TRANSPORT-OXIDOREDUCTASE complex
Deposited on 2012-04-09, released 2012-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Flavocytochrome c heme subunit
  Species: Thermochromatium tepidum [TaxId:1050]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0G7Q3 (0-173)
  Domains in SCOPe 2.08: d3vrda1, d3vrda2
• Chain 'B':
  Compound: Flavocytochrome c flavin subunit
  Species: Thermochromatium tepidum [TaxId:1050]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0G7Q4 (Start-400)
• Heterogens: HEC, GOL, NO3, FAD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3vrdA (A:)
  eptaemlanncagchgtrgnsagpaspsiaqmdpavfvevmeqfksgeiqstimgriakg
  ystadfqkmaeyfkqqtyqpvkqsfdkalvakgtklhdkycekchvesgkpladqdeyhi
  lagqwtpylryaiedfraerrpmekkmasklkellkaegedgldalfafyasqq
  

  
  
• Chain 'B':
  No sequence available.