PDB entry 3vr8

View 3vr8 on RCSB PDB site
Description: Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode Ascaris suum
Class: oxidoreductase
Keywords: Ascaris suum, membrane protein, reductase, mitochondria membrane, OXIDOREDUCTASE
Deposited on 2012-04-07, released 2012-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flavoprotein subunit of complex II
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Iron-sulfur subunit of succinate dehydrogenase
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vr8b1, d3vr8b2
  • Chain 'C':
    Compound: Cytochrome b-large subunit
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Flavoprotein subunit of complex II
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Iron-sulfur subunit of succinate dehydrogenase
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vr8f1, d3vr8f2
  • Chain 'G':
    Compound: Cytochrome b-large subunit
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MLI, FAD, FES, SF4, F3S, HEM, RQX, EPH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vr8B (B:)
    mlrgstsvcrslelvtqaaryasaataaaptgkriktfeiyrfnpeepgakpklqkfdvd
    ldkcgtmvldalikiknevdptltfrrscregicgscamniagentlacicnidqntskt
    tkiyplphmfvikdlvpdmnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldgly
    ecilcaccsascpsywwnadkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkch
    timnctktcpkhlnparaigeikmlltkmktkpaplptpanf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vr8B (B:)
    kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
    icgscamniagentlacicnidqntskttkiyplphmfvikdlvpdmnlfyaqyasiqpw
    lqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwnadkylgpavlmqay
    rwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnparaigeikmlltkmktk
    paplptpan
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3vr8F (F:)
    mlrgstsvcrslelvtqaaryasaataaaptgkriktfeiyrfnpeepgakpklqkfdvd
    ldkcgtmvldalikiknevdptltfrrscregicgscamniagentlacicnidqntskt
    tkiyplphmfvikdlvpdmnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldgly
    ecilcaccsascpsywwnadkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkch
    timnctktcpkhlnparaigeikmlltkmktkpaplptpanf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vr8F (F:)
    kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
    icgscamniagentlacicnidqntskttkiyplphmfvikdlvpdmnlfyaqyasiqpw
    lqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwnadkylgpavlmqay
    rwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnparaigeikmlltkmktk
    paplptpan
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.