PDB entry 3vqz

View 3vqz on RCSB PDB site
Description: Crystal structure of metallo-beta-lactamase, SMB-1, in a complex with mercaptoacetic acid
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-04-02, released 2013-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase
    Species: Serratia marcescens [TaxId:615]
    Gene: SMB-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3vqza_
  • Heterogens: ZN, NA, MCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vqzA (A:)
    qdrdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgf
    klsdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnf
    pgsakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavs
    adsyrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdng
    acraiaaagrkrletrlasekr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vqzA (A:)
    rdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgfkl
    sdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgsnfpgsa
    kvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavsadsy
    rfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdngacra
    iaaagrkrletrlasek