PDB entry 3vpx

View 3vpx on RCSB PDB site
Description: Crystal structure of leucine dehydrogenase from a psychrophilic bacterium Sporosarcina psychrophila.
Class: oxidoreductase
Keywords: Rossmann fold, leucine dehydrogense, NAD/leucine binding, Oxidoreductase
Deposited on 2012-03-14, released 2013-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.243
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucine dehydrogenase
    Species: Sporosarcina psychrophila [TaxId:1476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vpxa1, d3vpxa2
  • Chain 'B':
    Compound: leucine dehydrogenase
    Species: Sporosarcina psychrophila [TaxId:1476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vpxb1, d3vpxb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vpxA (A:)
    meifkymehqdyeqlvicqdkasglkaiiaihdttlgpalggtrmwtyaseeeaiedalr
    largmtyknaaaglnlgggktviignpktdkndemfrafgryieglngryitaedvgtte
    admdlinletdyvtgtsagagssgnpspvtaygiyygmkaaakeafgddslagktvavqg
    vgnvayalceylheegakliitdineeavqravdafgatavgineiysqeadifapcalg
    aiindetipqlkakviagsannqlketrhgdlihemgivyapdyvinsggvinvadeldg
    ynreralkrvegiydvigkifaiskrdniptyvaadrmaeeriarvantrstflqneksv
    lsrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vpxA (A:)
    meifkymehqdyeqlvicqdkasglkaiiaihdttlgpalggtrmwtyaseeeaiedalr
    largmtyknaaaglnlgggktviignpktdkndemfrafgryieglngryitaedvgtte
    admdlinletdyvtgtsnpspvtaygiyygmkaaakeafgddslagktvavqgvgnvaya
    lceylheegakliitdineeavqravdafgatavgineiysqeadifapcalgaiindet
    ipqlkakviagsannqlketrhgdlihemgivyapdyvinsggvinvadeldgynreral
    krvegiydvigkifaiskrdniptyvaadrmaeeriarvantrstflqneksvlsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vpxB (B:)
    meifkymehqdyeqlvicqdkasglkaiiaihdttlgpalggtrmwtyaseeeaiedalr
    largmtyknaaaglnlgggktviignpktdkndemfrafgryieglngryitaedvgtte
    admdlinletdyvtgtsagagssgnpspvtaygiyygmkaaakeafgddslagktvavqg
    vgnvayalceylheegakliitdineeavqravdafgatavgineiysqeadifapcalg
    aiindetipqlkakviagsannqlketrhgdlihemgivyapdyvinsggvinvadeldg
    ynreralkrvegiydvigkifaiskrdniptyvaadrmaeeriarvantrstflqneksv
    lsrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vpxB (B:)
    meifkymehqdyeqlvicqdkasglkaiiaihdttlgpalggtrmwtyaseeeaiedalr
    largmtyknaaaglnlgggktviignpktdkndemfrafgryieglngryitaedvgtte
    admdlinletdyvtgtsaganpspvtaygiyygmkaaakeafgddslagktvavqgvgnv
    ayalceylheegakliitdineeavqravdafgatavgineiysqeadifapcalgaiin
    detipqlkakviagsannqlketrhgdlihemgivyapdyvinsggvinvadeldgynre
    ralkrvegiydvigkifaiskrdniptyvaadrmaeeriarvantrstflqneksvlsr