PDB entry 3vpk

View 3vpk on RCSB PDB site
Description: Crystal Structure of 6-Guanidinohexanoyl Trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: ACYL-ENZYME INTERMEDIATE, SERINE PROTEASE INHIBITOR, TRYPSIN, SERINE PROTEASE, DIGESTION, ANTI-PANCREATITIS DRUG, LEAVING GROUP, CATALYTIC WATER MOLECULE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-03-05, released 2012-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vpka_
  • Heterogens: GHS, CA, E4B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vpkA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn