PDB entry 3voo

View 3voo on RCSB PDB site
Description: Cytochrome P450SP alpha (CYP152B1) mutant A245E
Class: oxidoreductase
Keywords: Cytochrome P450, Oxidoreductase
Deposited on 2012-01-31, released 2013-02-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid alpha-hydroxylase
    Species: SPHINGOMONAS PAUCIMOBILIS [TaxId:13689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24782 (0-406)
      • engineered mutation (236)
    Domains in SCOPe 2.03: d3vooa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vooA (A:)
    gpdetlslladpyrfisrqcqrlganafesrfllkktnclkgakaaeifydttrferega
    mpvaiqktllgqggvqgldgethrhrkqmfmglmtpervralaqlfeaewrravpgwtrk
    geivfydelhepltravcawagvplpddeagnragelralfdaagsasprhlwsrlarrr
    vdawakriiegiragsigsgsgtaayaiawhrdrhddllsphvaavelvnvlrptveiav
    yitfvahalqtcsgiraalvqqpdyaelfvqevrrfypffpavvarasqdfewegmafpe
    grqvvldlygsnhdaatwadpqefrperfrawdedsfnfipqgggdhylghrcpgewivl
    aimkvaahllvnamrydvpdqdlsidfarlpalpksgfvmrnvhigg