PDB entry 3voe

View 3voe on RCSB PDB site
Description: Crystal Structure of wild type MarR (apo form) from E.coli
Class: transcription
Keywords: winged helix-turn-helix DNA binding domain, TRANSCRIPTION
Deposited on 2012-01-21, released 2013-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.246
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: multiple antibiotic resistance protein marr
    Species: Escherichia coli [TaxId:83333]
    Gene: b1530, cfxB, inaR, JW5248, marR, soxQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3voea_
  • Chain 'B':
    Compound: multiple antibiotic resistance protein marr
    Species: Escherichia coli [TaxId:83333]
    Gene: b1530, cfxB, inaR, JW5248, marR, soxQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3voeb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3voeA (A:)
    mkstsdlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlcsircaacitpvel
    kkvlsvdlgaltrmldrlvckgwverlpnpndkrgvlvklttggaaiceqchqlvgqdlh
    qeltknltadevatleyllkkvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3voeA (A:)
    neiiplgrlihmvnqkkdrllneylsplditaaqfkvlcsircaacitpvelkkvlsvdl
    galtrmldrlvckgwverlpnpndkrgvlvklttggaaiceqchqlvgqdlhqeltknlt
    adevatleyllkkvlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3voeB (B:)
    mkstsdlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlcsircaacitpvel
    kkvlsvdlgaltrmldrlvckgwverlpnpndkrgvlvklttggaaiceqchqlvgqdlh
    qeltknltadevatleyllkkvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3voeB (B:)
    eiiplgrlihmvnqkkdrllneylsplditaaqfkvlcsircaacitpvelkkvlsvdlg
    altrmldrlvckgwverlpnpndkrgvlvklttggaaiceqchqlvgqdlhqeltknlta
    devatleyllkkvlp