PDB entry 3vob

View 3vob on RCSB PDB site
Description: Staphylococcus aureus FtsZ with PC190723
Class: cell cycle/inhibitor
Keywords: FTSZ, GTP-BINDING, TUBULIN HOMOLOG, POLYMERIZATION, GTPASE, CELL DIVISION, CELL CYCLE-INHIBITOR complex
Deposited on 2012-01-20, released 2012-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.199
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3voba1, d3voba2
  • Heterogens: CA, GDP, 9PC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vobA (A:)
    ghmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrg
    lgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgalt
    vgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadn
    vlrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissp
    lletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivv
    tviatgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vobA (A:)
    atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
    ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
    vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
    qgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissplle
    tsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtvi
    atgf