PDB entry 3voa

View 3voa on RCSB PDB site
Description: Staphylococcus aureus FtsZ 12-316 GDP-form
Class: cell cycle
Keywords: ftsz, GTP-binding, tubulin homolog, polymerization, gtpase, cell division, cell cycle
Deposited on 2012-01-20, released 2012-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.19
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A029 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3voaa1, d3voaa2, d3voaa3
  • Heterogens: GDP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3voaA (A:)
    ghmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrg
    lgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgalt
    vgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadn
    vlrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissp
    lletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivv
    tviatgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3voaA (A:)
    ghmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrg
    lgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgalt
    vgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadn
    vlrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissp
    lletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivv
    tviatgf