PDB entry 3vo9

View 3vo9 on RCSB PDB site
Description: Staphylococcus aureus FtsZ apo-form (SeMet)
Class: cell cycle
Keywords: ftsz, GTP-binding, tubulin homolog, polymerization, gtpase, cell division, cell cycle
Deposited on 2012-01-20, released 2012-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vo9a1, d3vo9a2
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vo9b1, d3vo9b2
  • Chain 'C':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vo9c1, d3vo9c2
  • Chain 'D':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vo9d1, d3vo9d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vo9A (A:)
    ghmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrg
    lgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgalt
    vgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadn
    vlrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissp
    lletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivv
    tviatgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vo9A (A:)
    atlkvigvggggnnavnrmidnvefiaintdgqalnlskaeskiqigekltrglgaganp
    eigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgvvtrp
    fsfetqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlrqgvqgisdl
    iavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgv
    lmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vo9B (B:)
    ghmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrg
    lgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgalt
    vgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadn
    vlrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissp
    lletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivv
    tviatgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vo9B (B:)
    atlkvigvggggnnavnrmidnvefiaintdgqalnlskaeskiqigekltrglgaganp
    eigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgvvtrp
    ftqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlrqgvqgisdliav
    sgevnldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmn
    itggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vo9C (C:)
    ghmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrg
    lgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgalt
    vgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadn
    vlrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissp
    lletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivv
    tviatgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vo9C (C:)
    atlkvigvggggnnavnrmidnnvefiaintdgqalnlskaeskiqigekltrglgagan
    peigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgvvtr
    pfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlrqgv
    qgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissplletsi
    vgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatg
    f
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vo9D (D:)
    ghmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrg
    lgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgalt
    vgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadn
    vlrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissp
    lletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivv
    tviatgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vo9D (D:)
    tlkvigvggggnnavnrmidhvefiaintdgqalnlskaeskiqigekltrganpeigkk
    aaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgvvtrpftqaa
    agveamkaavdtlivipndrlldivdkstpmmeafkeadnvlrqgvqgisdliavsgevn
    ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
    slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf