PDB entry 3vo3

View 3vo3 on RCSB PDB site
Description: Crystal Structure of the Kinase domain of Human VEGFR2 with imidazo[1,2-b]pyridazine derivative
Class: transferase/transferase inhibitor
Keywords: vegfr2, kinase domain, Tyrosin-protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-01-19, released 2013-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.162
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: KDR, FLK1, VEGFR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vo3a_
  • Heterogens: 0KF, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vo3A (A:)
    gamdpdelpldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcr
    tvavkmlkegathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgn
    lstylrskrnefvpykeapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarn
    illseknvvkicdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgv
    llweifslgaspypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptf
    selvehlgnllqanaqqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vo3A (A:)
    pldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlk
    egathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrsk
    rnefvpykdlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkic
    dfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgasp
    ypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllq
    ana