PDB entry 3vo2

View 3vo2 on RCSB PDB site
Description: Crystal structure of Zea mays leaf ferredoxin-NADP+ reductase III
Class: oxidoreductase
Keywords: Rossmann Fold, Oxidoreductase, FAD binding
Deposited on 2012-01-18, released 2012-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.199
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vo2a1, d3vo2a2
  • Chain 'B':
    Compound: Putative uncharacterized protein
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vo2b1, d3vo2b2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vo2A (A:)
    mvsttetaaagpaktskkqdeglvtnkykpkepyvgrclsntritgddapgetwhmvfst
    egeipyregqsigiiadgedkngkphklrlysiassalgdfgdsktvslcvkrlvytndq
    geivkgvcsnflcdlkpgadvkitgpvgkemlmpkdpnatvimlatgtgiapfrsflwkm
    fleehedykfsglawlflgvptsdsllykeelekmkemapdnfrldfavsreqtnaagek
    myiqtrmaeyreelwellkkdntyvymcglkgmekgiddimlnlaakdgidwmqykkqlk
    kgeqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vo2A (A:)
    tskkqdeglvtnkykpkepyvgrclsntritgddapgetwhmvfstegeipyregqsigi
    iadgedkngkphklrlysiassalgdfgdsktvslcvkrlvytndqgeivkgvcsnflcd
    lkpgadvkitgpvgkemlmpkdpnatvimlatgtgiapfrsflwkmfleehedykfsgla
    wlflgvptsdsllykeelekmkemapdnfrldfavsreqtnaagekmyiqtrmaeyreel
    wellkkdntyvymcglkgmekgiddimlnlaakdgidwmqykkqlkkgeqwnvevy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vo2B (B:)
    mvsttetaaagpaktskkqdeglvtnkykpkepyvgrclsntritgddapgetwhmvfst
    egeipyregqsigiiadgedkngkphklrlysiassalgdfgdsktvslcvkrlvytndq
    geivkgvcsnflcdlkpgadvkitgpvgkemlmpkdpnatvimlatgtgiapfrsflwkm
    fleehedykfsglawlflgvptsdsllykeelekmkemapdnfrldfavsreqtnaagek
    myiqtrmaeyreelwellkkdntyvymcglkgmekgiddimlnlaakdgidwmqykkqlk
    kgeqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vo2B (B:)
    tskkqdeglvtnkykpkepyvgrclsntritgddapgetwhmvfstegeipyregqsigi
    iadgedkngkphklrlysiassalgdfgdsktvslcvkrlvytndqgeivkgvcsnflcd
    lkpgadvkitgpvgkemlmpkdpnatvimlatgtgiapfrsflwkmfleehedykfsgla
    wlflgvptsdsllykeelekmkemapdnfrldfavsreqtnaagekmyiqtrmaeyreel
    wellkkdntyvymcglkgmekgiddimlnlaakdgidwmqykkqlkkgeqwnvevy