PDB entry 3vnt

View 3vnt on RCSB PDB site
Description: Crystal Structure of the Kinase domain of Human VEGFR2 with a [1,3]thiazolo[5,4-b]pyridine derivative
Class: transferase/transferase inhibitor
Keywords: vegfr2, kinase domain, Tyrosin-protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-01-17, released 2012-04-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.153
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: KDR, FLK1, VEGFR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3vnta_
  • Heterogens: 0JA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vntA (A:)
    gamdpdelpldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcr
    tvavkmlkegathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgn
    lstylrskrnefvpykeapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarn
    illseknvvkicdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgv
    llweifslgaspypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptf
    selvehlgnllqanaqqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vntA (A:)
    pldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlk
    egathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrsk
    rnefvpykykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdf
    glardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspyp
    gvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqan
    a