PDB entry 3vnp

View 3vnp on RCSB PDB site
Description: Crystal structure of hypothetical protein (GK2848) from Geobacillus Kaustophilus
Class: structural genomics, unknown function
Keywords: Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2012-01-17, released 2012-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical conserved protein
    Species: Geobacillus kaustophilus [TaxId:235909]
    Gene: GK2848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5KW03 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d3vnpa1, d3vnpa2
  • Chain 'B':
    Compound: Hypothetical conserved protein
    Species: Geobacillus kaustophilus [TaxId:235909]
    Gene: GK2848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5KW03 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d3vnpb1, d3vnpb2
  • Chain 'C':
    Compound: Hypothetical conserved protein
    Species: Geobacillus kaustophilus [TaxId:235909]
    Gene: GK2848
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5KW03 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d3vnpc1, d3vnpc2
  • Heterogens: ACY, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vnpA (A:)
    gmiypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqd
    nsilhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagsl
    vppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqqqrtscadkk
    elp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vnpA (A:)
    gmiypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqd
    nsilhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagsl
    vppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vnpB (B:)
    gmiypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqd
    nsilhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagsl
    vppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqqqrtscadkk
    elp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vnpB (B:)
    gmiypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqd
    nsilhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagsl
    vppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vnpC (C:)
    gmiypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqd
    nsilhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagsl
    vppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqqqrtscadkk
    elp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vnpC (C:)
    gmiypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqd
    nsilhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagsl
    vppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqq