PDB entry 3vmf

View 3vmf on RCSB PDB site
Description: Archaeal protein
Class: translation
Keywords: translation termination, TRANSLATION
Deposited on 2011-12-12, released 2012-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-alpha
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: tuf, APE_1844
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vmfa1, d3vmfa2, d3vmfa3
  • Chain 'B':
    Compound: Peptide chain release factor subunit 1
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: prf1, APE_1988.1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GTP, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vmfA (A:)
    gshmaekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfaw
    ildkmkeerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsa
    rkgefeagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfm
    kglgyqvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripv
    qnvysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigf
    avrgvsksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssr
    iieikakldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnr
    tvgigivtdvkpakvdikak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vmfA (A:)
    kphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkmk
    eerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgefe
    agmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgyq
    vdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppakpvdkplripvqnvysi
    pgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlqqaepgdnigfavrgvs
    ksdikrgdvaghldkpptvaeefearifviwhpsaitvgytpvihvhtasvssriieika
    kldpktgqvveqnpqflkagdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgigi
    vtdvkpa
    

  • Chain 'B':
    No sequence available.