PDB entry 3vm9

View 3vm9 on RCSB PDB site
Description: Dimeric horse myoglobin
Class: oxygen storage
Keywords: myoglobin, oxygen storage, oxygen binding, oxygen transport
Deposited on 2011-12-09, released 2012-09-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-09-12, with a file datestamp of 2012-09-07.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.128
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3vm9a_
  • Chain 'B':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3vm9b_
  • Heterogens: O, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vm9A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vm9B (B:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg