PDB entry 3vm4

View 3vm4 on RCSB PDB site
Description: Cytochrome P450SP alpha (CYP152B1) in complex with (R)-ibuprophen
Class: oxidoreductase
Keywords: Cytochrome P450, OXIDOREDUCTASE
Deposited on 2011-12-08, released 2012-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.16
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid alpha-hydroxylase
    Species: SPHINGOMONAS PAUCIMOBILIS [TaxId:13689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vm4a_
  • Heterogens: HEM, IZP, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vm4A (A:)
    gpdetlslladpyrfisrqcqrlganafesrfllkktnclkgakaaeifydttrferega
    mpvaiqktllgqggvqgldgethrhrkqmfmglmtpervralaqlfeaewrravpgwtrk
    geivfydelhepltravcawagvplpddeagnragelralfdaagsasprhlwsrlarrr
    vdawakriiegiragsigsgsgtaayaiawhrdrhddllsphvaavelvnvlrptvaiav
    yitfvahalqtcsgiraalvqqpdyaelfvqevrrfypffpavvarasqdfewegmafpe
    grqvvldlygsnhdaatwadpqefrperfrawdedsfnfipqgggdhylghrcpgewivl
    aimkvaahllvnamrydvpdqdlsidfarlpalpksgfvmrnvhigg