PDB entry 3vlb

View 3vlb on RCSB PDB site
Description: Crystal structure of xeg-edgp
Class: plant protein/hydrolase
Keywords: cell-wall, PLANT PROTEIN-HYDROLASE complex
Deposited on 2011-11-30, released 2012-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.262
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: edgp
    Species: DAUCUS CAROTA [TaxId:4039]
    Gene: EDGP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vlba_
  • Chain 'B':
    Compound: Xyloglucan-specific endo-beta-1,4-glucanase A
    Species: Aspergillus aculeatus [TaxId:5053]
    Gene: xgeA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vlbb_
  • Chain 'C':
    Compound: edgp
    Species: DAUCUS CAROTA [TaxId:4039]
    Gene: EDGP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vlbc_
  • Chain 'D':
    Compound: Xyloglucan-specific endo-beta-1,4-glucanase A
    Species: Aspergillus aculeatus [TaxId:5053]
    Gene: xgeA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vlbd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vlbA (A:)
    qpsfrpsalvvpvkkdastlqyvttinqrtplvsenlvvdlggrflwvdcdqnyvsstyr
    pvrcrtsqcslsgsiacgdcfngprpgcnnntcgvfpenpvintatggevaedvvsvest
    dgsssgrvvtvprfifscaptsllqnlasgvvgmaglgrtrialpsqfasafsfkrkfam
    clsgstssnsviifgndpytflpniivsdktltytplltnpvstsatstqgepsveyfig
    vksikinskivalntsllsissaglggtkistinpytvletsiykavteafikesaarni
    trvasvapfgacfstdnilstrlgpsvpsidlvlqsesvvwtitgsnsmvyindnvvclg
    vvdggsnlrtsivigghqlednlvqfdlatsrvgfsgtllgsrttcanfnfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vlbA (A:)
    rpsalvvpvkkdastlqyvttinqrtplvsenlvvdlggrflwvdcdqnyvsstyrpvrc
    rtsqcslsgsiacgdcfnggcnnntcgvfpenpvintatggevaedvvsvestdgsssgr
    vvtvprfifscaptsllqnlasgvvgmaglgrtrialpsqfasafsfkrkfamclsgsts
    snsviifgndpytflpniivsdktltytplltnpvstsattqgepsveyfigvksikins
    kivalntsllsissaglggtkistinpytvletsiykavteafikesaarnitrvasvap
    fgacfstdnilstrlgpsvpsidlvlqsesvvwtitgsnsmvyindnvvclgvvdggsnl
    rtsivigghqlednlvqfdlatsrvgfsgtllgsrttcanfnft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vlbB (B:)
    gplgsdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggss
    svksyvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimv
    wlaalggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndff
    tylvdnegvsdelylttleagtepftgsnakltvseysisie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vlbB (B:)
    sdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggsssvks
    yvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimvwlaa
    lggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndfftylv
    dnegvsdelylttleagtepftgsnakltvseysisie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vlbC (C:)
    qpsfrpsalvvpvkkdastlqyvttinqrtplvsenlvvdlggrflwvdcdqnyvsstyr
    pvrcrtsqcslsgsiacgdcfngprpgcnnntcgvfpenpvintatggevaedvvsvest
    dgsssgrvvtvprfifscaptsllqnlasgvvgmaglgrtrialpsqfasafsfkrkfam
    clsgstssnsviifgndpytflpniivsdktltytplltnpvstsatstqgepsveyfig
    vksikinskivalntsllsissaglggtkistinpytvletsiykavteafikesaarni
    trvasvapfgacfstdnilstrlgpsvpsidlvlqsesvvwtitgsnsmvyindnvvclg
    vvdggsnlrtsivigghqlednlvqfdlatsrvgfsgtllgsrttcanfnfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vlbC (C:)
    rpsalvvpvkkdastlqyvttinqrtplvsenlvvdlggrflwvdcdqnyvsstyrpvrc
    rtsqcslsgsiacgdcfgcnnntcgvfpenpvintatggevaedvvsvestdgsssgrvv
    tvprfifscaptsllqnlasgvvgmaglgrtrialpsqfasafsfkrkfamclsgstssn
    sviifgndpytflpniivsdktltytplltnpvstsatstqgepsveyfigvksikinsk
    ivalntsllsissaglggtkistinpytvletsiykavteafikesaarnitrvasvapf
    gacfstdnilstrlgpsvpsidlvlqsesvvwtitgsnsmvyindnvvclgvvdggsnlr
    tsivigghqlednlvqfdlatsrvgfsgtllgsrttcanfnft
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vlbD (D:)
    gplgsdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggss
    svksyvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimv
    wlaalggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndff
    tylvdnegvsdelylttleagtepftgsnakltvseysisie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vlbD (D:)
    sdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggsssvks
    yvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimvwlaa
    lggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndfftylv
    dnegvsdelylttleagtepftgsnakltvseysisie