PDB entry 3vl9

View 3vl9 on RCSB PDB site
Description: Crystal structure of xeg-xyloglucan
Class: hydrolase
Keywords: hydrolase
Deposited on 2011-11-30, released 2012-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.129
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xyloglucan-specific endo-beta-1,4-glucanase A
    Species: Aspergillus aculeatus [TaxId:5053]
    Gene: xgeA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vl9a_
  • Chain 'B':
    Compound: Xyloglucan-specific endo-beta-1,4-glucanase A
    Species: Aspergillus aculeatus [TaxId:5053]
    Gene: xgeA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vl9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vl9A (A:)
    gplgsaslqrrsdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtsw
    swsggsssvksyvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgs
    skyeimvwlaalggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfs
    gdlndfftylvdnegvsdelylttleagtepftgsnakltvseysisie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vl9A (A:)
    lqrrsdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggss
    svksyvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimv
    wlaalggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndff
    tylvdnegvsdelylttleagtepftgsnakltvseysisie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vl9B (B:)
    gplgsaslqrrsdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtsw
    swsggsssvksyvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgs
    skyeimvwlaalggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfs
    gdlndfftylvdnegvsdelylttleagtepftgsnakltvseysisie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vl9B (B:)
    qrrsdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggsss
    vksyvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimvw
    laalggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndfft
    ylvdnegvsdelylttleagtepftgsnakltvseysisie