PDB entry 3vl8

View 3vl8 on RCSB PDB site
Description: Crystal structure of XEG
Class: hydrolase
Keywords: hydrolase
Deposited on 2011-11-30, released 2012-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xyloglucan-specific endo-beta-1,4-glucanase A
    Species: Aspergillus aculeatus [TaxId:5053]
    Gene: xgeA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vl8a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vl8A (A:)
    gplgsaslqrrsdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtsw
    swsggsssvksyvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgs
    skyeimvwlaalggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfs
    gdlndfftylvdnegvsdelylttleagtepftgsnakltvseysisie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vl8A (A:)
    qrrsdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggsss
    vksyvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimvw
    laalggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndfft
    ylvdnegvsdelylttleagtepftgsnakltvseysisie