PDB entry 3vl6

View 3vl6 on RCSB PDB site
Description: 3-isopropylmalate dehydrogenase from Shewanella oneidensis MR-1 at 580 MPa
Class: oxidoreductase
Keywords: 3-isopropylmalate dehydrogenase, ipmdh, high-pressure, diamond-anvil cell, dac, oxidoreductase
Deposited on 2011-11-29, released 2012-02-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: leuB, SO_4235
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8E9N3 (12-374)
      • expression tag (11)
    Domains in SCOPe 2.06: d3vl6a1, d3vl6a2
  • Heterogens: IPM, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vl6A (A:)
    mrgshhhhhhgssyqiavlagdgigpevmaearkvlkavearfglnieyteydvggiaid
    nhgcplpeatlkgceaadailfgsvggpkweklppneqpergallplrghfelfcnlrpa
    klhdglehmsplrsdisargfdvlcvreltggiyfgkpkgrqgegeseeafdtmrysrre
    isriariafeaargrrkkvtsvdkanvlacsvlwrqvveevavdfpdvelehiyidnatm
    qllrrpdefdvmlcsnlfgdilsdeiamltgsmgllssasmnstgfglfepaggsapdia
    gkgianpiaqilsaalmlrhslkqeeaasaieravtkalnsgyltgellssdqrhkaktt
    vqmgdfiadavkagv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vl6A (A:)
    ssyqiavlagdgigpevmaearkvlkavearfglnieyteydvggiaidnhgcplpeatl
    kgceaadailfgsvggpkweklppneqpergallplrghfelfcnlrpaklhdglehmsp
    lrsdisargfdvlcvreltggiyfgkpkgrqgegeseeafdtmrysrreisriariafea
    argrrkkvtsvdkanvlacsvlwrqvveevavdfpdvelehiyidnatmqllrrpdefdv
    mlcsnlfgdilsdeiamltgsmgllssasmnstgfglfepaggsapdiagkgianpiaqi
    lsaalmlrhslkqeeaasaieravtkalnsgyltgellssdqrhkakttvqmgdfiadav
    kagv