PDB entry 3vkv

View 3vkv on RCSB PDB site
Description: Complex structure of Lactobacillus casei lactate dehydrogenase with fructose-1,6-bisphosphate
Class: oxidoreductase
Keywords: Rossmann Fold, Dehydrogenase, NADH Binding, OXIDOREDUCTASE
Deposited on 2011-11-22, released 2011-12-21
Made obsolete by 6j9t on 2019-02-06

The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vkva1, d3vkva2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vkvb1, d3vkvb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vkvc1, d3vkvc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vkvd1, d3vkvd2
  • Chain 'E':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vkve1, d3vkve2
  • Chain 'F':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vkvf1, d3vkvf2
  • Heterogens: SO4, FBP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vkvA (A:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkvA (A:)
    dkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkk
    iysaeysdakdadlvvitagaptrldlvnknlkilksivdpivdsgfngiflvaanpvdi
    ltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtefpvws
    haniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalariskai
    lndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasqlk
    kvltdaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vkvB (B:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkvB (B:)
    dkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkk
    iysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaa
    npvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdte
    fpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalar
    iskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqks
    asqlkkvltdafa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vkvC (C:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkvC (C:)
    kdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkki
    ysaeysdakdadlvvitagknlkilksivdpivdsgfngiflvaanpvdiltyatwklsg
    fpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtia
    ewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlpl
    svymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vkvD (D:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkvD (D:)
    kdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkki
    ysaeysdakdadlvvitagaptrldlvnknlkilksivdpivdsgfngiflvaanpvdil
    tyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwsh
    aniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalariskail
    ndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasqlkk
    vltdaf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3vkvE (E:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkvE (E:)
    kdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkki
    ysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaan
    pvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtef
    pvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalari
    skailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksa
    sqlkkvltdaf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3vkvF (F:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkvF (F:)
    kdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkki
    ysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaan
    pvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtef
    pvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalari
    skailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksa
    sqlkkvltdafa