PDB entry 3vku

View 3vku on RCSB PDB site
Description: Penta mutant of Lactobacillus casei lactate dehydrogenase
Class: oxidoreductase
Keywords: Rossmann Fold, Dehydrogenase, NADH Binding, OXIDOREDUCTASE
Deposited on 2011-11-22, released 2012-11-28
Made obsolete by 6j9s on 2019-02-06

The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.209
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00343
      • engineered mutation (54-55)
      • engineered mutation (163)
      • engineered mutation (222-223)
    Domains in SCOPe 2.03: d3vkua1, d3vkua2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00343
      • engineered mutation (54-55)
      • engineered mutation (163)
      • engineered mutation (222-223)
    Domains in SCOPe 2.03: d3vkub1, d3vkub2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00343
      • engineered mutation (54-55)
      • engineered mutation (163)
      • engineered mutation (222-223)
    Domains in SCOPe 2.03: d3vkuc1, d3vkuc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00343
      • engineered mutation (54-55)
      • engineered mutation (163)
      • engineered mutation (222-223)
    Domains in SCOPe 2.03: d3vkud1, d3vkud2
  • Chain 'E':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00343
      • engineered mutation (54-55)
      • engineered mutation (163)
      • engineered mutation (222-223)
    Domains in SCOPe 2.03: d3vkue1, d3vkue2
  • Chain 'F':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00343
      • engineered mutation (54-55)
      • engineered mutation (163)
      • engineered mutation (222-223)
    Domains in SCOPe 2.03: d3vkuf1, d3vkuf2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vkuA (A:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkuA (A:)
    kdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpftspkki
    ysaeysdakdadlvvitagapilksivdpivdsgfngiflvaanpvdiltyatwklsgfp
    knrvvgsgtsldtarfrqsiakmvnvdarsvhayimgehgdtefpvwshaniggvtiaew
    vkahpeikedklvkmfedvrnkayeiiklkgatfygiatalariskailndenavlplsv
    ymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasqlkkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vkuB (B:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkuB (B:)
    kdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpftspkki
    ysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaan
    pvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimgehgdtef
    pvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygiatalari
    skailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksa
    sqlkkvltdaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vkuC (C:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkuC (C:)
    sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpfts
    pkkiysaeysdakdadlvvitagaknlkilksivdpivdsgfngiflvaanpvdiltyat
    wklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimgehgdtefpvwshanig
    gvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygiatalariskailnden
    avlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasqlkkvlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vkuD (D:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkuD (D:)
    sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpfts
    pkkiysaeysdakdadlvvitagknlkilksivdpivdsgfngiflvaanpvdiltyatw
    klsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimgehgdtefpvwshanigg
    vtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygiatalariskailndena
    vlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltda
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3vkuE (E:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkuE (E:)
    dkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpftspkk
    iysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaa
    npvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimgehgdte
    fpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygiatalar
    iskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqks
    asqlkkvltdaf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3vkuF (F:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkuF (F:)
    itdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpftsp
    kkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflv
    aanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimgehgd
    tefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygiatal
    ariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmq
    ksasqlkkvltdafa