PDB entry 3vko

View 3vko on RCSB PDB site
Description: Galectin-8 N-terminal domain in complex with sialyllactosamine
Class: sugar binding protein
Keywords: beta-sandwich, carbohydrate binding, oligosaccharide, SUGAR BINDING PROTEIN
Deposited on 2011-11-18, released 2012-09-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vkoa_
  • Chain 'B':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vkob_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vkoA (A:)
    mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpra
    dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
    khtllyghrigpekidtlgiygkvnihsigfsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkoA (A:)
    nlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
    nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
    ghrigpekidtlgiygkvnihsigfsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vkoB (B:)
    mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpra
    dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
    khtllyghrigpekidtlgiygkvnihsigfsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vkoB (B:)
    nlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
    nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
    ghrigpekidtlgiygkvnihsigfsf