PDB entry 3vkm

View 3vkm on RCSB PDB site
Description: Protease-resistant mutant form of Human Galectin-8 in complex with sialyllactose and lactose
Class: sugar binding protein
Keywords: beta-sandwich, carbohydrate binding, oligosaccharide, sugar binding protein
Deposited on 2011-11-18, released 2012-09-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: 0.2
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (0-154)
      • linker (155-156)
    • Uniprot O00214 (157-290)
    Domains in SCOPe 2.05: d3vkma1, d3vkma2
  • Chain 'B':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (0-154)
      • linker (155-156)
    • Uniprot O00214 (157-290)
    Domains in SCOPe 2.05: d3vkmb1, d3vkmb2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vkmA (A:)
    mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpra
    dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
    khtllyghrigpekidtlgiygkvnihsigfsfsshmrlpfaarlntpmgpgrtvvvkge
    vnanaksfnvdllagkskdialhlnprlnikafvrnsflqeswgeeernitsfpfspgmy
    femiiycdvrefkvavngvhsleykhrfkelssidtleingdihllevrsw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vkmB (B:)
    mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpra
    dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
    khtllyghrigpekidtlgiygkvnihsigfsfsshmrlpfaarlntpmgpgrtvvvkge
    vnanaksfnvdllagkskdialhlnprlnikafvrnsflqeswgeeernitsfpfspgmy
    femiiycdvrefkvavngvhsleykhrfkelssidtleingdihllevrsw