PDB entry 3vjn

View 3vjn on RCSB PDB site
Description: Crystal structure of the mutated EGFR kinase domain (G719S/T790M) in complex with AMPPNP.
Class: transferase
Keywords: receptor, disease mutation, cell cycle, drug resistance, kinase, tyrosine-protein kinase, transferase, ATP binding, phosphorylation, transmembrane
Deposited on 2011-10-27, released 2012-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.197
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (30)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d3vjna_
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vjnA (A:)
    gamgirsgeapnqallrilketefkkikvlssgafgtvykglwipegekvkipvaikelr
    eatspkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdn
    igsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeeke
    yhaeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissile
    kgerlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermh
    lpsptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vjnA (A:)
    eapnqallrilketefkkikvlssgtvykglwipegekvkipvaikeleatspkankeil
    deayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvq
    iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikw
    malesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppict
    idvymimvkcwmidadsrpkfreliiefskmardpqrylviqgddmddvvdadeyli