PDB entry 3vj7

View 3vj7 on RCSB PDB site
Description: Crystal structure of the carboxy-terminal ribonuclease domain of Colicin E5 R33Q mutant
Class: Hydrolase
Keywords: ribonuclease, Hydrolase
Deposited on 2011-10-13, released 2011-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Colicin-E5
    Species: Escherichia coli [TaxId:562]
    Gene: col
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18000
      • engineered mutation (31)
    Domains in SCOPe 2.07: d3vj7a_
  • Heterogens: 3PD, UM3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vj7A (A:)
    aegklndelaknkgkipglkidqkirgqmpeqgwteddikntvsngatgtsfdkrspkkt
    ppdylgrndpatvygspgkyvvvndrtgevtqisdktdpgwvddsriqwgnkndq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vj7A (A:)
    pglkidqkirgqmpeqgwteddikntvsngatgtsfdkrspkktppdylgrndpatvygs
    pgkyvvvndrtgevtqisdktdpgwvddsriqwg