PDB entry 3vhx

View 3vhx on RCSB PDB site
Description: The crystal structure of Arf6-MKLP1 (Mitotic kinesin-like protein 1) complex
Class: cell cycle/signaling protein
Keywords: Small GTPase, GTP Binding, Flemming body, Cytokinesis, CELL CYCLE-SIGNALING PROTEIN complex
Deposited on 2011-09-12, released 2012-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.203
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 6
    Species: Mus musculus [TaxId:10090]
    Gene: ARF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62331 (1-End)
      • expression tag (0)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d3vhxa1, d3vhxa2
  • Chain 'B':
    Compound: Kinesin-like protein KIF23
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF23, KNSL5, MKLP1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ADP-ribosylation factor 6
    Species: Mus musculus [TaxId:10090]
    Gene: ARF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62331 (1-End)
      • expression tag (0)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d3vhxc1, d3vhxc2
  • Chain 'D':
    Compound: Kinesin-like protein KIF23
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF23, KNSL5, MKLP1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ADP-ribosylation factor 6
    Species: Mus musculus [TaxId:10090]
    Gene: ARF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62331 (1-End)
      • expression tag (0)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d3vhxe1, d3vhxe2
  • Chain 'F':
    Compound: Kinesin-like protein KIF23
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF23, KNSL5, MKLP1
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: ADP-ribosylation factor 6
    Species: Mus musculus [TaxId:10090]
    Gene: ARF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62331 (1-End)
      • expression tag (0)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d3vhxg1, d3vhxg2
  • Chain 'H':
    Compound: Kinesin-like protein KIF23
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF23, KNSL5, MKLP1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GTP, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vhxA (A:)
    memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
    plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
    pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnykslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhxA (A:)
    memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
    plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
    pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vhxC (C:)
    memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
    plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
    pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnykslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhxC (C:)
    memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
    plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
    pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3vhxE (E:)
    memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
    plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
    pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnykslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhxE (E:)
    memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
    plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
    pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3vhxG (G:)
    memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
    plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
    pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnykslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhxG (G:)
    memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
    plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
    pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny
    

  • Chain 'H':
    No sequence available.